PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G04900.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family NF-YA
Protein Properties Length: 269aa    MW: 29522.8 Da    PI: 7.5271
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G04900.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.71.9e-33167223158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep+YVNaKQy++Il+RRq Rakle+e+kl  k+rkpylheSRh+hA++R+Rg+gGrF
  LPERR03G04900.2 167 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKNRKPYLHESRHQHAMKRARGTGGRF 223
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.8E-39165226IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.283166226IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.5E-29168223IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.2E-25169191IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860171191IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.2E-25200223IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MLPPHLTVDE ALRFGDAFLG GGELAATIYD SYCIILAENG TVMIQFGHQM PDYESSATQS  60
TSGSPREVSG MSEGSRNEQN DQSGNLNGYS KSDEGKMMSA LSLGKSETVY AHSEPDRSQP  120
FAISYPYADS FYGGAVATYG SHAIMHPQIV GMMSSSRVPL PIEPATEEPI YVNAKQYHAI  180
LRRRQLRAKL EAENKLVKNR KPYLHESRHQ HAMKRARGTG GRFLNTKQQS ESSDGGTPRD  240
HAANGVVFSK HEHGLSSSDL HHRRAREGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-24167229264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8327050.0CT832705.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA105G23, full insert sequence.
GenBankEU8470060.0EU847006.1 Oryza sativa Japonica Group clone KCS364E08 CCAAT-binding transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631822.11e-161PREDICTED: nuclear transcription factor Y subunit A-7
SwissprotQ9LVJ74e-44NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLA0A0D9VQ490.0A0A0D9VQ49_9ORYZ; Uncharacterized protein
STRINGORGLA03G0053200.11e-163(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.12e-45nuclear factor Y, subunit A6